Language:
  
[Sign in] [Register]   

EIAab logo

Index > Protein center > ASPRO(Shorten name) > Human
  • Add your favorite
  • ASPRO (Shorten name),
  • top
  • Come back to page head.
  • |
  • General Annotation
  • |
  • General Annotation
  • |
  • 3D
  • |
  • Predicted Eptitope
  • |
  • Vaild Sequence
  • |
  • Citations  (1)
  • |
  • Feedback
  • Shorten name:
    ASPRO;
    Antigen name:
    Asprosin;
    Alternative:

    General Annotation
    Sub Unit:
    Asprosin, a fasting-induced glucogenic protein homone that modulates hepatic glucose release. It is the C-terminal cleavage product of profibrillin, and encoded by the ultimate two exons of FBN1.
    Function:
    Circulating asprosin, a protein hormone, responds to low dietary glucose by triggering the release of liver glucose stores, and the reduction of asprosin protects against the hyperinsulinism associated with metabolic syndrome.
    Location:
    Asprosin circulates at nanomolar levels, a single dose of recombinant asprosin retains biological activity and elevates blood glucose and insulin levels. Liver is the target organ for asprosin to recruit. Asprosin increases hepatocyte glucose release through activating the G protein-cAMP-PKA pathway.
    Antigen Attributes:
    Formula:
    STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHN RYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDK DYLSGELGDNLKMKIQVLLH
    3D Structure:
    N/A
    Predicted Eptitope:
    Please Sign in.
    EIAab Sequence  Vaild Sequence:
    Please Sign in.
     
    FOR
    ELISA Kit for Human Asprosin
    Cat.:
    E15190h
    Price:
    Please sign in first.
    MSDS:
    Please sign in first.
    Packing:
    96T
    Range:
    Please sign in first.
    CLIA Kit for Human Asprosin
    Cat.:
    U15190h
    Price:
    Please sign in first.
    MSDS:
    Please sign in first.
    Packing:
    96T
    Polyclonal Antibody for Human Asprosin
    Cat.:
    P15190Rb-h
    Price:
    Please sign in first.
    Packing:
    40ug/0.2ml
    Monoclonal Antibody for Human Asprosin
    Protein for Human Asprosin

    R&D Technical Data

    IPTG induced Asprosin protein expressionIPTG induced Asprosin protein expression               

    12% SDS-PAGE analysis                      12% SDS-PAGE analysis 

    Western blot - Anti- Asprosin antibody   Western blot - Anti- Asprosin antibody 

    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    Precision

    Intra-assay Precision (Precision within an assay):Three samples of known concentration were tested twenty times on one plate to assess intra-assay precision.

    Intra-Assay CV: ≤ 6.5%

    Inter-assay Precision (Precision between assays):Three samples of known concentration were tested in five separate assays to assess inter-assay precision.

    Inter-Assay CV: ≤ 9.8%

    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    Recovery

    Recovery was determined by spiking various levels of ACE into serum and plasma .

    Sample Type

    Average(%)

    Recovery Range(%)

    Serum

    99

    93-105

    Plasma

    101

    95-107

     

     

     

     

    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    Linearity

     

    The linearity of the kit was assayed by testing samples spiked with appropriate concentration of ACE and their serial dilutions. The results were demonstrated by the percentage of calculated concentration to the expected.  

     

    Sample

    1:2

    1:4

    1:8

    1:16

    serum(n=5)

    97-105%

    93-101%

    95-104%

    99-109%

    EDTA plasma(n=5)

    90-99%

    98- 105%

    89-97%

    95-106%

    heparin plasma(n=5)

    95-104%

     

    99-110%

    100-111%

    97-110%

     

    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    References
    Product Feedback Wall
    Hot Genes
    ALCAM ACE KSR2 ASPRO C19orf80 Gdf5 Trap1a Atf2
    Top Searches
    Asprosin Ubiquitin ELISA Ubiquitin-protein ligase TRAP1A metalloproteinase Tumor necrosis vitamin d
    Why choose EIAAB
    Our products have been quoted by many publications in famous journals such as Cell; Cell Metabolism; Hepatology; Biomaterials.more
    Further Information
    About us Protein center Bank account Distributors Terms & Conditions Career eiaab.cn

    Copyright & copy www.eiaab.com2006-2016 All Rights Reserved    EIAab         Email:eiaab@eiaab.com

    Twitter